Grp75/HSPA9 Antibody orb315150 from Biorbyt

Product Specs
ItemGrp75/HSPA9 Antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb315150
Quantity10 µg, 100 µg
ApplicationsFC, IHC, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Monkey, Mouse
TargetGrp75/HSPA9
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences
NCBI Full Gene Nameheat shock protein family A (Hsp70) member 9
NCBI Gene AliasesCRP40, CSA, EVPLS, GRP-75, GRP75, HEL-S-124m, HSPA9B, MOT, MOT2, MTHSP75, PBP74, SAAN, SIDBA4
ClonalityPolyclonal
Molecular Weight73680 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Western blot, 0.1-0.5µg/ml, Human, Monkey, Mouse Immunohistochemistry (Paraffin-embedded Section), 2-5µg/ml, Human, By Heat Flow Cytometry, 1-3 µg/1x106 cells, Human

Add to Compare List